PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00431.1.g00550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 180aa    MW: 20339.7 Da    PI: 8.9588
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00431.1.g00550.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.11.7e-072569345
                                    SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
                 Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                                    +W++ Ed+ +  a   ++     +W+++a++++ gRt+ +  +++q
  Zmw_sc00431.1.g00550.1.sm.mkhc 25 PWSKAEDKVFESALVTFPEQvpnRWALVASMLP-GRTAQEAWDHYQ 69
                                    8*****************99*************.****99888887 PP

2Myb_DNA-binding46.39.5e-15112156347
                                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                 Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                     +WT+eE+ l++++ +++G g+W+ I+r   k+Rt+ q+ s+ qky
  Zmw_sc00431.1.g00550.1.sm.mkhc 112 PWTEEEHRLFLEGLEKYGRGDWRNISRWSVKTRTPTQVASHAQKY 156
                                     8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007175.6E-42274IPR001005SANT/Myb domain
SuperFamilySSF466896.01E-112372IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-62470IPR009057Homeodomain-like
CDDcd001672.25E-52563No hitNo description
PfamPF002495.2E-62569IPR001005SANT/Myb domain
PROSITE profilePS500906.9462572IPR017877Myb-like domain
PROSITE profilePS5129420.291105161IPR017930Myb domain
SuperFamilySSF466891.79E-18107162IPR009057Homeodomain-like
SMARTSM007179.2E-11109159IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.4E-17109160IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.4E-11111155IPR009057Homeodomain-like
CDDcd001672.59E-11112157No hitNo description
PfamPF002491.2E-11112156IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MAYYYNYGVG GQSSAAPMGA PCSRPWSKAE DKVFESALVT FPEQVPNRWA LVASMLPGRT  60
AQEAWDHYQA LVVDVDRIER GMVEAPDAWD EEGRSAGAGR GRGGDERRRG VPWTEEEHRL  120
FLEGLEKYGR GDWRNISRWS VKTRTPTQVA SHAQKYFIRQ ANAANRVDTK RKSIHDITTP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638220.15e-95PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H72e-48DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLI1PW299e-96I1PW29_ORYGL; Uncharacterized protein
STRINGORGLA05G0157700.13e-95(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687